PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g48447.1.p
Common NameBRADI_3g48447, LOC100834218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 326aa    MW: 34238 Da    PI: 5.0992
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g48447.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.41.5e-082861337
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkgH 37
                      +r C++++   ++l+C++++ +lC  C    H gH
  Bradi3g48447.1.p 28 ARPCDTCGVDAARLYCRTDGAYLCGGCDARAH-GH 61
                      578*****999********************9.88 PP

2zf-B_box24.74.8e-0871116342
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                        + C+ +e+ ++   C+ +   lC+ C   +H+       H++vp+
  Bradi3g48447.1.p  71 VWLCDVCEQAPVAVTCRADAAALCAACDADIHSAnplagrHERVPV 116
                       679*****************************66999999999986 PP

3CCT69.21e-23245287143
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                       Rea+l+RY+eKrk+R+F K+irY+sRKa+Ae+RpR+KGrF+k+
  Bradi3g48447.1.p 245 REARLMRYREKRKNRRFHKTIRYASRKAYAETRPRIKGRFAKR 287
                       9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575117No hitNo description
PROSITE profilePS501199.9112673IPR000315B-box-type zinc finger
SMARTSM003360.0322666IPR000315B-box-type zinc finger
PfamPF006434.0E-62961IPR000315B-box-type zinc finger
CDDcd000211.30E-62973No hitNo description
PROSITE profilePS5011910.09669116IPR000315B-box-type zinc finger
SMARTSM003361.6E-1369116IPR000315B-box-type zinc finger
PfamPF006433.3E-671116IPR000315B-box-type zinc finger
PROSITE profilePS5101716.718245287IPR010402CCT domain
PfamPF062034.8E-18245287IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MKAEEMPVVV GGAGGGCWGQ QQQQQQGARP CDTCGVDAAR LYCRTDGAYL CGGCDARAHG  60
HGGAGSRHAR VWLCDVCEQA PVAVTCRADA AALCAACDAD IHSANPLAGR HERVPVAPFF  120
GALAHEADAA AAHKEEDGSN EEAEAASWLL PEPGDSPEAE DTAAFFADSD AYLGLDLDFV  180
RSMDGINAIG VPVASSELDL AAAGTLFYPD HSMNHSVSSS EVAVVPDAMS LGAAAAVVVS  240
RGKDREARLM RYREKRKNRR FHKTIRYASR KAYAETRPRI KGRFAKRTGT GTADDDALEH  300
DDGPFSPAVS ALVASDGDYG IVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235683.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3-like
TrEMBLA0A0Q3IIA70.0A0A0Q3IIA7_BRADI; Uncharacterized protein
STRINGBRADI3G48447.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.14e-49CONSTANS-like 3